AnvilCore Research
IGF-1 LR3 research material is available in the strength shown below. Select a tab to review the available format.
Technical research description
IGF-1 LR3 is a long-acting laboratory analogue of insulin-like growth factor 1 with an Arg substitution at position 3 and an N-terminal extension. These changes reduce binding to IGF-binding proteins while retaining IGF-1 receptor activity, making it useful for studies of growth signaling, metabolism, and PI3K-AKT and MAPK pathways.
IGF-1 LR3 is a long-acting laboratory analogue of insulin-like growth factor 1 with an Arg substitution at position 3 and an N-terminal extension. These changes reduce binding to IGF-binding proteins while retaining IGF-1 receptor activity, making it useful for studies of growth signaling, metabolism, and PI3K-AKT and MAPK pathways.
Amino-acid sequence
MFPAMPLSSLFVNGPRTLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPAKSA
83-amino-acid Long R3 IGF-1 sequence shown in one-letter notation.
IGF-1 LR3 — 1 mg
- Strength
- 1 mg
- Format
- Powder
- Retail price (USD)
- $72.00
Adds IGF-1 LR3 — 1 mg to your cart. Research and laboratory use only.
Research use only. Not for human consumption or clinical, diagnostic, or therapeutic use.